PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr040949.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 166aa    MW: 17977.6 Da    PI: 8.2834
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr040949.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.69e-43461451100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGa+n++k+l++lpe++r da+ss++yeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  Pbr040949.1  46 PCAACKILRRRCAEKCVLAPYFPPSEPVKFTIAHRVFGANNIIKFLQELPESQRADAVSSMLYEASARIRDPVYGCAGAICHLQKQVNELQAQLAKAQ 143
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Pbr040949.1 144 AE 145
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.00245146IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4246143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MECSTETMNT NYTTTSSTMS QSPPSSSPSS PPTPTPTPSP PVVIRPCAAC KILRRRCAEK  60
CVLAPYFPPS EPVKFTIAHR VFGANNIIKF LQELPESQRA DAVSSMLYEA SARIRDPVYG  120
CAGAICHLQK QVNELQAQLA KAQAELVDMQ RQQANHVVLI SSTIT*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008370637.14e-83PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-70LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5W0703e-76M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA13G40370.23e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-60LOB domain-containing protein 1